HES4 (NM_001142467) Human Recombinant Protein
CAT#: TP327268
Recombinant protein of human hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1, 20 µg
View other "HES4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227268 representing NM_001142467
Red=Cloning site Green=Tags(s) MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEK RRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGF HECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGG PFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001135939 |
| Locus ID | 57801 |
| UniProt ID | Q9HCC6 |
| Cytogenetics | 1p36.33 |
| Refseq ORF | 741 |
| Synonyms | bHLHb42 |
| Summary | Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3' (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412047 | HES4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428113 | HES4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412047 | Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 2 |
CNY 3080.00 |
|
| LY428113 | Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1 |
CNY 3080.00 |
|
| PH327268 | HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) |
CNY 14250.00 |
