HES4 (NM_001142467) Human Mass Spec Standard
CAT#: PH327268
HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939)
View other "HES4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227268 |
| Predicted MW | 25.9 kDa |
| Protein Sequence |
>RC227268 representing NM_001142467
Red=Cloning site Green=Tags(s) MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEK RRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGF HECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGG PFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135939 |
| RefSeq ORF | 741 |
| Synonyms | bHLHb42 |
| Locus ID | 57801 |
| Cytogenetics | 1p36.33 |
| Summary | Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3' (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412047 | HES4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428113 | HES4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412047 | Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 2 |
CNY 3080.00 |
|
| LY428113 | Transient overexpression lysate of hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1 |
CNY 3080.00 |
|
| TP327268 | Recombinant protein of human hairy and enhancer of split 4 (Drosophila) (HES4), transcript variant 1, 20 µg |
CNY 2900.00 |
