TSEN2 (NM_001145392) Human Recombinant Protein
CAT#: TP326917
Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2, 20 µg
View other "TSEN2" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226917 protein sequence
Red=Cloning site Green=Tags(s) MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138864 |
Locus ID | 80746 |
UniProt ID | Q8NCE0 |
Refseq Size | 2150 |
Cytogenetics | 3p25.2 |
Refseq ORF | 1395 |
Synonyms | PCH2B; SEN2; SEN2L |
Summary | This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410823 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428856 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428858 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428859 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410823 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1 |
CNY 3080.00 |
|
LY428856 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2 |
CNY 3080.00 |
|
LY428858 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 4 |
CNY 3080.00 |
|
LY428859 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 5 |
CNY 3080.00 |
|
PH305156 | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_079541) |
CNY 19520.00 |
|
PH326917 | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_001138864) |
CNY 19520.00 |
|
TP305156 | Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1, 20 µg |
CNY 2900.00 |