TSEN2 (NM_001145392) Human Mass Spec Standard
CAT#: PH326917
TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_001138864)
View other "TSEN2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_001138864) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226917 |
| Predicted MW | 53.2 kDa |
| Protein Sequence |
>RC226917 protein sequence
Red=Cloning site Green=Tags(s) MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138864 |
| RefSeq Size | 2150 |
| RefSeq ORF | 1395 |
| Synonyms | PCH2B; SEN2; SEN2L |
| Locus ID | 80746 |
| Cytogenetics | 3p25.2 |
| Summary | This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410823 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428856 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428858 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428859 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410823 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1 |
CNY 3080.00 |
|
| LY428856 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2 |
CNY 3080.00 |
|
| LY428858 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 4 |
CNY 3080.00 |
|
| LY428859 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 5 |
CNY 3080.00 |
|
| PH305156 | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_079541) |
CNY 19520.00 |
|
| TP305156 | Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326917 | Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2, 20 µg |
CNY 2900.00 |
