LANCL1 (NM_001136575) Human Recombinant Protein
CAT＃: TP326718
Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3, 20 µg
View other "LANCL1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226718 protein sequence
Red=Cloning site Green=Tags(s) MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001130047 |
| Locus ID | 10314 |
| UniProt ID | O43813 |
| Refseq Size | 4526 |
| Cytogenetics | 2q34 |
| Refseq ORF | 1197 |
| Synonyms | GPR69A; p40 |
| Summary | This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401823 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427929 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427930 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401823 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1 |
CNY 3080.00 |
|
| LY427929 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2 |
CNY 3080.00 |
|
| LY427930 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3 |
CNY 3080.00 |
|
| PH305279 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_006046) |
CNY 19520.00 |
|
| PH326718 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047) |
CNY 19520.00 |
|
| PH327716 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) |
CNY 19520.00 |
|
| TP305279 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327716 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2, 20 µg |
CNY 2900.00 |
