LANCL1 (NM_001136575) Human Mass Spec Standard
CAT#: PH326718
LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047)
View other "LANCL1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226718 |
| Predicted MW | 45.3 kDa |
| Protein Sequence |
>RC226718 protein sequence
Red=Cloning site Green=Tags(s) MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001130047 |
| RefSeq Size | 4526 |
| RefSeq ORF | 1197 |
| Synonyms | GPR69A; p40 |
| Locus ID | 10314 |
| Cytogenetics | 2q34 |
| Summary | This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401823 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427929 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427930 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401823 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1 |
CNY 3080.00 |
|
| LY427929 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2 |
CNY 3080.00 |
|
| LY427930 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3 |
CNY 3080.00 |
|
| PH305279 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_006046) |
CNY 19520.00 |
|
| PH327716 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) |
CNY 19520.00 |
|
| TP305279 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326718 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP327716 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2, 20 µg |
CNY 2900.00 |
