LRRC8A (NM_001127244) Human Recombinant Protein
CAT#: TP326180
Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1, 20 µg
View other "LRRC8A" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226180 protein sequence
Red=Cloning site Green=Tags(s) MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 94 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120716 |
Locus ID | 56262 |
UniProt ID | Q8IWT6 |
Refseq Size | 4637 |
Cytogenetics | 9q34.11 |
Refseq ORF | 2430 |
Synonyms | AGM5; HsLRRC8A; LRRC8; SWELL1 |
Summary | This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412721 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426737 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426738 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY412721 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 |
CNY 3080.00 |
|
LY426737 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 |
CNY 4840.00 |
|
LY426738 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 |
CNY 4840.00 |
|
PH308632 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540) |
CNY 19520.00 |
|
PH326180 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120716) |
CNY 19520.00 |
|
PH326181 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120717) |
CNY 19520.00 |
|
TP308632 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326181 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3, 20 µg |
CNY 2900.00 |