LRRC8A (NM_019594) Human Mass Spec Standard
CAT＃: PH308632
LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540)
View other "LRRC8A" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208632 |
| Predicted MW | 94.2 kDa |
| Protein Sequence |
>RC208632 protein sequence
Red=Cloning site Green=Tags(s) MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_062540 |
| RefSeq Size | 4368 |
| RefSeq ORF | 2430 |
| Synonyms | AGM5; HsLRRC8A; LRRC8; SWELL1 |
| Locus ID | 56262 |
| Cytogenetics | 9q34.11 |
| Summary | This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412721 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426737 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426738 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY412721 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 |
CNY 3080.00 |
|
| LY426737 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 |
CNY 4840.00 |
|
| LY426738 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 |
CNY 4840.00 |
|
| PH326180 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120716) |
CNY 19520.00 |
|
| PH326181 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120717) |
CNY 19520.00 |
|
| TP308632 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326180 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326181 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3, 20 µg |
CNY 2900.00 |
