TBC1D5 (NM_001134380) Human Recombinant Protein
CAT#: TP326171
Recombinant protein of human TBC1 domain family, member 5 (TBC1D5), transcript variant 3, 20 µg
View other "TBC1D5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226171 protein sequence
Red=Cloning site Green=Tags(s) MYHSLSETRHPLQPEEQEVGIDPLSSYSNKSGGDSNKNGRRTSSTLDSEGTFNSYRKEWEELFVNNNYLA TIRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISRIEELRAWYSNIKEIHITNPRKVVGQQDLMINN PLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELL APIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQLMETAEPWFSTFEHDGQKGKETLM TPIPFARPQDLGPTIAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLV VWDALFADGLSLGLVDYIFVAMLLYIRDALISSNYQTCLGLLMHYPFIGDVHSLILKALFLRDPKRNPRP VTYQFHPNLDYYKARGADLMNKSRTNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSS SSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSAT KKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLE KEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQAS SETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASS SNPSSSPDDDSSKDSGFTIVSPLDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 88.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001127852 |
Locus ID | 9779 |
UniProt ID | Q92609 |
Refseq Size | 6631 |
Cytogenetics | 3p24.3 |
Refseq ORF | 2385 |
Synonyms | KIAA0210 |
Summary | May act as a GTPase-activating protein (GAP) for Rab family protein(s). May act as a GAP for RAB7A. Can displace RAB7A and retromer CSC subcomplex from the endosomal membrane to the cytosol; at least retromer displacement seems to require its catalytic activity (PubMed:19531583, PubMed:20923837). Required for retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN); the function seems to require its catalytic activity. Involved in regulation of autophagy (PubMed:22354992). May act as a molecular switch between endosomal and autophagosomal transport and is involved in reprogramming vesicle trafficking upon autophagy induction. Involved in the trafficking of ATG9A upon activation of autophagy. May regulate the recruitment of ATG9A-AP2-containing vesicles to autophagic membranes (PubMed:24603492).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415062 | TBC1D5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427408 | TBC1D5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY415062 | Transient overexpression lysate of TBC1 domain family, member 5 (TBC1D5), transcript variant 2 |
CNY 3080.00 |
|
LY427408 | Transient overexpression lysate of TBC1 domain family, member 5 (TBC1D5), transcript variant 3 |
CNY 4840.00 |
|
PH304401 | TBC1D5 MS Standard C13 and N15-labeled recombinant protein (NP_055559) |
CNY 19520.00 |
|
PH326171 | TBC1D5 MS Standard C13 and N15-labeled recombinant protein (NP_001127852) |
CNY 19520.00 |
|
TP304401 | Recombinant protein of human TBC1 domain family, member 5 (TBC1D5), transcript variant 2, 20 µg |
CNY 2900.00 |