KLC2 (NM_001134776) Human Recombinant Protein
CAT#: TP326035
Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 4, 20 µg
View other "KLC2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226035 protein sequence
Red=Cloning site Green=Tags(s) MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 68.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001128248 |
| Locus ID | 64837 |
| UniProt ID | Q9H0B6 |
| Refseq Size | 2972 |
| Cytogenetics | 11q13.2 |
| Refseq ORF | 1866 |
| Summary | The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402950 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427490 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427491 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427492 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402950 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 1 |
CNY 3080.00 |
|
| LY427490 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 2 |
CNY 3080.00 |
|
| LY427491 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 3 |
CNY 3080.00 |
|
| LY427492 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 4 |
CNY 3080.00 |
|
| PH314206 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733) |
CNY 19520.00 |
|
| PH326034 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128247) |
CNY 19520.00 |
|
| PH326035 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248) |
CNY 19520.00 |
|
| TP314206 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326034 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 3, 20 µg |
CNY 2900.00 |
