KLC2 (NM_022822) Human Mass Spec Standard
CAT＃: PH314206
KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733)
View other "KLC2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214206 |
| Predicted MW | 68.8 kDa |
| Protein Sequence |
>RC214206 representing NM_022822
Red=Cloning site Green=Tags(s) MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_073733 |
| RefSeq Size | 2992 |
| RefSeq ORF | 1866 |
| Locus ID | 64837 |
| Cytogenetics | 11q13.2 |
| Summary | The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402950 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427490 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427491 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427492 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402950 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 1 |
CNY 3080.00 |
|
| LY427490 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 2 |
CNY 3080.00 |
|
| LY427491 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 3 |
CNY 3080.00 |
|
| LY427492 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 4 |
CNY 3080.00 |
|
| PH326034 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128247) |
CNY 19520.00 |
|
| PH326035 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248) |
CNY 19520.00 |
|
| TP314206 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326034 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP326035 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 4, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
