CRPPA (NM_001101417) Human Recombinant Protein
CAT#: TP325626
Recombinant protein of human notch1-induced protein (LOC729920), transcript variant 2, 20 µg
View other "CRPPA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225626 representing NM_001101417
Red=Cloning site Green=Tags(s) MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAVLPAGGCGERMGVPTPKQFCP ILERPLISYTLQALERVCWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAED QINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHGCSDYDLEFGTECLQLALKYCCTKAKLVEGSPD LWKVTYKRDLYAAESIIKERISQEICVVMDTEEDNKHVGHLLEEVLKSELNHVKVTSEALGHAGRHLQQI ILDQCYNFVCVNVTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQIREFAKE VKERNILLYGLLISYPQDDQKLQESLRQGAIIIASLIKERNSGLIGQLLIA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001094887 |
| Locus ID | 729920 |
| UniProt ID | A4D126 |
| Cytogenetics | 7p21.2 |
| Refseq ORF | 1203 |
| Synonyms | hISPD; ISPD; LGMDR20; MDDGA7; MDDGC7; Nip |
| Summary | This gene encodes a 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein. Mutations in this gene are the cause of Walker-Warburg syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426159 | ISPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426161 | ISPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426159 | Transient overexpression lysate of isoprenoid synthase domain containing (ISPD), transcript variant 2 |
CNY 3080.00 |
|
| LY426161 | Transient overexpression lysate of isoprenoid synthase domain containing (ISPD), transcript variant 1 |
CNY 3080.00 |
|
| PH325626 | ISPD MS Standard C13 and N15-labeled recombinant protein (NP_001094887) |
CNY 19520.00 |
|
| PH325744 | ISPD MS Standard C13 and N15-labeled recombinant protein (NP_001094896) |
CNY 19520.00 |
|
| TP325744 | Recombinant protein of human notch1-induced protein (LOC729920), transcript variant 1, 20 µg |
CNY 2900.00 |
