CRPPA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-hCG_1745121 antibody: synthetic peptide directed towards the N terminal of human hCG_1745121. Synthetic peptide located within the following region: MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	isoprenoid synthase domain containing
Database Link	NP_001094887 Entrez Gene 729920 Human UniProt ID A4D126
Background	The specific function of hCG_1745121 is not yet known.
Synonyms	hCG_1745121; MDDGA7; MDDGC7; Nip
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.