TACC1 (NM_001122824) Human Recombinant Protein
CAT#: TP325610
Recombinant protein of human transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 2, 20 µg
View other "TACC1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225610 representing NM_001122824
Red=Cloning site Green=Tags(s) MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFRSGCKVKKHETQSLALD ACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSS SEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIE ANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSD LFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESA ALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116296 |
Locus ID | 6867 |
UniProt ID | O75410 |
Cytogenetics | 8p11.22 |
Refseq ORF | 1185 |
Synonyms | Ga55 |
Summary | This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426566 | TACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431527 | TACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY426566 | Transient overexpression lysate of transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 2 |
CNY 3080.00 |
|
LY431527 | Transient overexpression lysate of transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 3 |
CNY 3080.00 |
|
PH325610 | TACC1 MS Standard C13 and N15-labeled recombinant protein (NP_001116296) |
CNY 19520.00 |