TACC1 (NM_001122824) Human Mass Spec Standard
CAT#: PH325610
TACC1 MS Standard C13 and N15-labeled recombinant protein (NP_001116296)
View other "TACC1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TACC1 MS Standard C13 and N15-labeled recombinant protein (NP_001116296) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225610 |
| Predicted MW | 43.8 kDa |
| Protein Sequence |
>RC225610 representing NM_001122824
Red=Cloning site Green=Tags(s) MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFRSGCKVKKHETQSLALD ACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSS SEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIE ANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSD LFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESA ALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001116296 |
| RefSeq ORF | 1185 |
| Synonyms | Ga55 |
| Locus ID | 6867 |
| Cytogenetics | 8p11.22 |
| Summary | This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426566 | TACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431527 | TACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426566 | Transient overexpression lysate of transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 2 |
CNY 3080.00 |
|
| LY431527 | Transient overexpression lysate of transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 3 |
CNY 3080.00 |
|
| TP325610 | Recombinant protein of human transforming, acidic coiled-coil containing protein 1 (TACC1), transcript variant 2, 20 µg |
CNY 2900.00 |


