ABIN3 (TNIP3) (NM_001128843) Human Recombinant Protein
CAT#: TP325469
Purified recombinant protein of Homo sapiens TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2, 20 µg
View other "ABIN3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225469 protein sequence
Red=Cloning site Green=Tags(s) MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRHRDLTRDRLQREEKEKERLNEELHELKEENKL LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001122315 |
Locus ID | 79931 |
UniProt ID | Q96KP6 |
Refseq Size | 2410 |
Cytogenetics | 4q27 |
Refseq ORF | 975 |
Synonyms | ABIN-3; LIND |
Summary | Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403041 | TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427001 | TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403041 | Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 1 |
CNY 3080.00 |
|
LY427001 | Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2 |
CNY 3080.00 |
|
PH325469 | TNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001122315) |
CNY 14250.00 |