ABIN3 (TNIP3) (NM_001128843) Human Mass Spec Standard
CAT#: PH325469
TNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001122315)
View other "ABIN3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | TNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001122315) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225469 |
| Predicted MW | 39 kDa |
| Protein Sequence |
>RC225469 protein sequence
Red=Cloning site Green=Tags(s) MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYER KVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRHRDLTRDRLQREEKEKERLNEELHELKEENKL LKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEED FKKERSDRERLNQEKEELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPW VPTGPGAVQKQREHPPDYQWYALDQLPPDVQHKANGLSSVKKVHP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001122315 |
| RefSeq Size | 2410 |
| RefSeq ORF | 975 |
| Synonyms | ABIN-3; LIND |
| Locus ID | 79931 |
| Cytogenetics | 4q27 |
| Summary | Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403041 | TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427001 | TNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403041 | Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 1 |
CNY 3080.00 |
|
| LY427001 | Transient overexpression lysate of TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2 |
CNY 3080.00 |
|
| TP325469 | Purified recombinant protein of Homo sapiens TNFAIP3 interacting protein 3 (TNIP3), transcript variant 2, 20 µg |
CNY 2900.00 |
