NUDT7 (NM_001105663) Human Recombinant Protein
CAT#: TP325300
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 7 (NUDT7), transcript variant 1, 20 µg
View other "NUDT7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225300 representing NM_001105663
Red=Cloning site Green=Tags(s) MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF EVQFNLNDVLASSEELFLKVHKKATSRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001099133 |
| Locus ID | 283927 |
| UniProt ID | P0C024 |
| Cytogenetics | 16q23.1 |
| Refseq ORF | 714 |
| Summary | The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426294 | NUDT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426294 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 7 (NUDT7), transcript variant 1 |
CNY 3080.00 |
|
| PH325300 | NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133) |
CNY 19520.00 |
