NUDT7 (NM_001105663) Human Mass Spec Standard
CAT#: PH325300
NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133)
View other "NUDT7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225300 |
| Predicted MW | 26.8 kDa |
| Protein Sequence |
>RC225300 representing NM_001105663
Red=Cloning site Green=Tags(s) MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF EVQFNLNDVLASSEELFLKVHKKATSRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001099133 |
| RefSeq ORF | 714 |
| Locus ID | 283927 |
| Cytogenetics | 16q23.1 |
| Summary | The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426294 | NUDT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426294 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 7 (NUDT7), transcript variant 1 |
CNY 3080.00 |
|
| TP325300 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 7 (NUDT7), transcript variant 1, 20 µg |
CNY 2900.00 |
