MECR (NM_016011) Human Recombinant Protein
CAT#: TP324634
Recombinant protein of human mitochondrial trans-2-enoyl-CoA reductase (MECR), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "MECR" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224634 protein sequence
Red=Cloning site Green=Tags(s) MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRG SDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRT EAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLR TINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGG TMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPL QDYQSALEASMKPFISSKQILTM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057095 |
| Locus ID | 51102 |
| UniProt ID | Q9BV79 |
| Refseq Size | 2539 |
| Cytogenetics | 1p35.3 |
| Refseq ORF | 1119 |
| Synonyms | CGI-63; DYTOABG; ETR1; FASN2B; NRBF1 |
| Summary | The protein encoded by this gene is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis. Defects in this gene are a cause of childhood-onset dystonia and optic atrophy. [provided by RefSeq, Mar 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Fatty acid elongation in mitochondria, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414252 | MECR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414252 | Transient overexpression lysate of mitochondrial trans-2-enoyl-CoA reductase (MECR), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH324634 | MECR MS Standard C13 and N15-labeled recombinant protein (NP_057095) |
CNY 19520.00 |
