SCN4B (NM_174934) Human Recombinant Protein
CAT#: TP323951
Recombinant protein of human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, 20 µg
View other "SCN4B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223951 representing NM_174934
Red=Cloning site Green=Tags(s) MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN TENGLPGSKAEEKPPSKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_777594 |
Locus ID | 6330 |
UniProt ID | Q8IWT1 |
Refseq Size | 4489 |
Cytogenetics | 11q23.3 |
Refseq ORF | 684 |
Synonyms | ATFB17; LQT10; Navbeta4 |
Summary | The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.[provided by RefSeq, Mar 2009] |
Protein Families | Ion Channels: Sodium, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406238 | SCN4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406238 | Transient overexpression lysate of sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1 |
CNY 3080.00 |
|
PH323951 | SCN4B MS Standard C13 and N15-labeled recombinant protein (NP_777594) |
CNY 19520.00 |