SCN4B (NM_174934) Human Mass Spec Standard
CAT#: PH323951
SCN4B MS Standard C13 and N15-labeled recombinant protein (NP_777594)
View other "SCN4B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SCN4B MS Standard C13 and N15-labeled recombinant protein (NP_777594) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223951 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC223951 representing NM_174934
Red=Cloning site Green=Tags(s) MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN TENGLPGSKAEEKPPSKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_777594 |
RefSeq Size | 4489 |
RefSeq ORF | 684 |
Synonyms | ATFB17; LQT10; Navbeta4 |
Locus ID | 6330 |
Cytogenetics | 11q23.3 |
Summary | The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.[provided by RefSeq, Mar 2009] |
Protein Families | Ion Channels: Sodium, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406238 | SCN4B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406238 | Transient overexpression lysate of sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1 |
CNY 3080.00 |
|
TP323951 | Recombinant protein of human sodium channel, voltage-gated, type IV, beta (SCN4B), transcript variant 1, 20 µg |
CNY 2900.00 |