ARMS2 (NM_001099667) Human Recombinant Protein
CAT#: TP323747
Recombinant protein of human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, 20 µg
View other "ARMS2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223747 representing NM_001099667
Red=Cloning site Green=Tags(s) MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001093137 |
| Locus ID | 387715 |
| UniProt ID | P0C7Q2 |
| Refseq Size | 823 |
| Cytogenetics | 10q26.13 |
| Refseq ORF | 321 |
| Synonyms | ARMD8 |
| Summary | This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. [provided by RefSeq, Sep 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420481 | ARMS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420481 | Transient overexpression lysate of age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH323747 | ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137) |
CNY 19520.00 |
|
| TP701006 | Purified recombinant protein of Human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, mutant (A69S), expressed in HEK293 cells, 20ug |
CNY 6650.00 |
