ARMS2 (NM_001099667) Human Mass Spec Standard
CAT#: PH323747
ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137)
View other "ARMS2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223747 |
Predicted MW | 11.3 kDa |
Protein Sequence |
>RC223747 representing NM_001099667
Red=Cloning site Green=Tags(s) MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001093137 |
RefSeq Size | 823 |
RefSeq ORF | 321 |
Synonyms | ARMD8 |
Locus ID | 387715 |
Cytogenetics | 10q26.13 |
Summary | This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. [provided by RefSeq, Sep 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420481 | ARMS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420481 | Transient overexpression lysate of age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP323747 | Recombinant protein of human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
|
TP701006 | Purified recombinant protein of Human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, mutant (A69S), expressed in HEK293 cells, 20ug |
CNY 6650.00 |