ARMS2 (NM_001099667) Human Mass Spec Standard
CAT#: PH323747
ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137)
View other "ARMS2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223747 |
| Predicted MW | 11.3 kDa |
| Protein Sequence |
>RC223747 representing NM_001099667
Red=Cloning site Green=Tags(s) MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001093137 |
| RefSeq Size | 823 |
| RefSeq ORF | 321 |
| Synonyms | ARMD8 |
| Locus ID | 387715 |
| Cytogenetics | 10q26.13 |
| Summary | This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. [provided by RefSeq, Sep 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420481 | ARMS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420481 | Transient overexpression lysate of age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP323747 | Recombinant protein of human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
|
| TP701006 | Purified recombinant protein of Human age-related maculopathy susceptibility 2 (ARMS2), nuclear gene encoding mitochondrial protein, mutant (A69S), expressed in HEK293 cells, 20ug |
CNY 6650.00 |
