METTL21D (VCPKMT) (NM_024558) Human Recombinant Protein
CAT＃: TP323670
Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 1, 20 µg
View other "METTL21D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223670 representing NM_024558
Red=Cloning site Green=Tags(s) MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEY RSEDIHIIYIRKKKSKFPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_078834 |
| Locus ID | 79609 |
| UniProt ID | Q9H867 |
| Refseq Size | 1784 |
| Cytogenetics | 14q21.3 |
| Refseq ORF | 687 |
| Synonyms | C14orf138; METTL21D; VCP-KMT |
| Summary | Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411191 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421803 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411191 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 1 |
CNY 3080.00 |
|
| LY421803 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 2 |
CNY 3080.00 |
|
| PH316594 | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_001035752) |
CNY 19520.00 |
|
| PH323670 | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_078834) |
CNY 19520.00 |
|
| TP316594 | Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 20 µg |
CNY 2900.00 |
其它METTL21D产品
