METTL21D (VCPKMT) (NM_001040662) Human Mass Spec Standard
CAT＃: PH316594
C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_001035752)
View other "METTL21D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
Specifications
| Product Data | |
| Description | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_001035752) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216594 |
| Predicted MW | 21.3 kDa |
| Protein Sequence |
>RC216594 representing NM_001040662
Red=Cloning site Green=Tags(s) MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFEKFPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035752 |
| RefSeq Size | 1679 |
| RefSeq ORF | 582 |
| Synonyms | C14orf138; METTL21D; VCP-KMT |
| Locus ID | 79609 |
| Cytogenetics | 14q21.3 |
| Summary | Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411191 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421803 | VCPKMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411191 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 1 |
CNY 3080.00 |
|
| LY421803 | Transient overexpression lysate of chromosome 14 open reading frame 138 (C14orf138), transcript variant 2 |
CNY 3080.00 |
|
| PH323670 | C14orf138 MS Standard C13 and N15-labeled recombinant protein (NP_078834) |
CNY 19520.00 |
|
| TP316594 | Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323670 | Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 1, 20 µg |
CNY 2900.00 |
其它METTL21D产品
Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 100 µg
