CERKL (NM_201548) Human Recombinant Protein
CAT＃: TP323592
Recombinant protein of human ceramide kinase-like (CERKL), transcript variant 1, 20 µg
View other "CERKL" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223592 representing NM_201548
Red=Cloning site Green=Tags(s) MPWRRRRNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRW RPIQPERPAGDSKYDLLCKEEFIELKDIFSVKLKRRCSVKQQRSGTLLGITLFICLKKEQNKLKNSTLDL INLSEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIKTDVTIMEYEG HALSLLKECELQGFDGVVCVGGDGSASEVAHALLLRAQKNAGMETDRILTPVRAQLPLGLIPAGSTNVLA HSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAMFGFGGRTLALAEKYRWMSPNQRRDFAV VKALAKLKAEDCEISFLPFNSSDDVQERRAQGSPKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAP NTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETA SENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMIPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_963842 |
| Locus ID | 375298 |
| UniProt ID | Q49MI3 |
| Refseq Size | 3123 |
| Cytogenetics | 2q31.3 |
| Refseq ORF | 1596 |
| Synonyms | RP26 |
| Summary | This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD). Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.[provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400410 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404454 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422210 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422211 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431449 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400410 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 2 |
CNY 4840.00 |
|
| LY404454 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 1 |
CNY 4840.00 |
|
| LY422210 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 3 |
CNY 4840.00 |
|
| LY422211 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 4 |
CNY 4840.00 |
|
| LY431449 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 7 |
CNY 3080.00 |
|
| PH323592 | CERKL MS Standard C13 and N15-labeled recombinant protein (NP_963842) |
CNY 14250.00 |
