CERKL (NM_201548) Human Mass Spec Standard
CAT＃: PH323592
CERKL MS Standard C13 and N15-labeled recombinant protein (NP_963842)
View other "CERKL" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | CERKL MS Standard C13 and N15-labeled recombinant protein (NP_963842) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223592 |
| Predicted MW | 59.4 kDa |
| Protein Sequence |
>RC223592 representing NM_201548
Red=Cloning site Green=Tags(s) MPWRRRRNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCDVVLSERALRW RPIQPERPAGDSKYDLLCKEEFIELKDIFSVKLKRRCSVKQQRSGTLLGITLFICLKKEQNKLKNSTLDL INLSEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIKTDVTIMEYEG HALSLLKECELQGFDGVVCVGGDGSASEVAHALLLRAQKNAGMETDRILTPVRAQLPLGLIPAGSTNVLA HSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAMFGFGGRTLALAEKYRWMSPNQRRDFAV VKALAKLKAEDCEISFLPFNSSDDVQERRAQGSPKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAP NTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETA SENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMIPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_963842 |
| RefSeq Size | 3123 |
| RefSeq ORF | 1596 |
| Synonyms | RP26 |
| Locus ID | 375298 |
| Cytogenetics | 2q31.3 |
| Summary | This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD). Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.[provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400410 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC404454 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422210 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422211 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431449 | CERKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400410 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 2 |
CNY 4840.00 |
|
| LY404454 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 1 |
CNY 4840.00 |
|
| LY422210 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 3 |
CNY 4840.00 |
|
| LY422211 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 4 |
CNY 4840.00 |
|
| LY431449 | Transient overexpression lysate of ceramide kinase-like (CERKL), transcript variant 7 |
CNY 3080.00 |
|
| TP323592 | Recombinant protein of human ceramide kinase-like (CERKL), transcript variant 1, 20 µg |
CNY 2900.00 |
