GMPR2 (NM_001002002) Human Recombinant Protein
CAT#: TP323106
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg
View other "GMPR2" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223106 protein sequence
Red=Cloning site Green=Tags(s) MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVE FVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAH GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002002 |
Locus ID | 51292 |
UniProt ID | Q9P2T1 |
Refseq Size | 1669 |
Cytogenetics | 14q12 |
Refseq ORF | 1044 |
Synonyms | GMPR 2 |
Summary | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413898 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424314 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424315 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424316 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413898 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 |
CNY 3080.00 |
|
LY424314 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 |
CNY 3080.00 |
|
LY424315 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 |
CNY 3080.00 |
|
LY424316 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 |
CNY 3080.00 |
|
PH303418 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) |
CNY 19520.00 |
|
PH303584 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) |
CNY 19520.00 |
|
PH310599 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) |
CNY 19520.00 |
|
PH323106 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) |
CNY 19520.00 |
|
TP303418 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP303584 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP310599 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg |
CNY 2900.00 |