GMPR2 (NM_001002002) Human Recombinant Protein
CAT#: TP323106
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4, 20 µg
View other "GMPR2" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223106 protein sequence
Red=Cloning site Green=Tags(s) MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVE FVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAH GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001002002 |
| Locus ID | 51292 |
| UniProt ID | Q9P2T1 |
| Refseq Size | 1669 |
| Cytogenetics | 14q12 |
| Refseq ORF | 1044 |
| Synonyms | GMPR 2 |
| Summary | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413898 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424314 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424315 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424316 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413898 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 |
CNY 3080.00 |
|
| LY424314 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 |
CNY 3080.00 |
|
| LY424315 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 |
CNY 3080.00 |
|
| LY424316 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 |
CNY 3080.00 |
|
| PH303418 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) |
CNY 19520.00 |
|
| PH303584 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) |
CNY 19520.00 |
|
| PH310599 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) |
CNY 19520.00 |
|
| PH323106 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) |
CNY 19520.00 |
|
| TP303418 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP303584 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP310599 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3, 20 µg |
CNY 2900.00 |
