GMPR2 Rabbit Polyclonal Antibody

CAT#: TA346626

Rabbit Polyclonal Anti-GMPR2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1
    • 100 ug

CNY 3080.00


Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GMPR2 antibody: synthetic peptide directed towards the C terminal of human GMPR2. Synthetic peptide located within the following region: GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 20 kDa
Gene Name guanosine monophosphate reductase 2
Background GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.
Synonyms GMPR 2
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 86%; Guinea pig: 86%; Zebrafish: 77%
Reference Data
Protein Families Druggable Genome
Protein Pathways Purine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...