FUT8 (NM_178155) Human Recombinant Protein
CAT#: TP323075
Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1, 20 µg
View other "FUT8" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223075 representing NM_178155
Red=Cloning site Green=Tags(s) MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE KIETVKYPTYPEAEK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 66.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_835368 |
| Locus ID | 2530 |
| UniProt ID | Q9BYC5 |
| Refseq Size | 3775 |
| Cytogenetics | 14q23.3 |
| Refseq ORF | 1725 |
| Synonyms | CDGF; CDGF1 |
| Summary | This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011] |
| Protein Families | Transmembrane |
| Protein Pathways | Keratan sulfate biosynthesis, Metabolic pathways, N-Glycan biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406001 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406002 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406003 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY406001 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2 |
CNY 4840.00 |
|
| LY406002 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1 |
CNY 4840.00 |
|
| LY406003 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 3 |
CNY 4840.00 |
|
| PH312345 | FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835367) |
CNY 19520.00 |
|
| PH323075 | FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835368) |
CNY 19520.00 |
|
| TP312345 | Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2, 20 µg |
CNY 2900.00 |
