FUT8 (NM_178154) Human Mass Spec Standard
CAT＃: PH312345
FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835367)
View other "FUT8" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835367) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212345 |
| Predicted MW | 66.3 kDa |
| Protein Sequence |
>RC212345 representing NM_178154
Red=Cloning site Green=Tags(s) MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE KIETVKYPTYPEAEK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_835367 |
| RefSeq Size | 3291 |
| RefSeq ORF | 1725 |
| Synonyms | MGC26465 |
| Locus ID | 2530 |
| Cytogenetics | 14q23.3 |
| Summary | This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011] |
| Protein Families | Transmembrane |
| Protein Pathways | Keratan sulfate biosynthesis, Metabolic pathways, N-Glycan biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406001 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406002 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406003 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY406001 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2 |
CNY 4840.00 |
|
| LY406002 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1 |
CNY 4840.00 |
|
| LY406003 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 3 |
CNY 4840.00 |
|
| PH323075 | FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835368) |
CNY 19520.00 |
|
| TP312345 | Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323075 | Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1, 20 µg |
CNY 2900.00 |
