USF2 (NM_207291) Human Recombinant Protein
CAT#: TP323006
Purified recombinant protein of Homo sapiens upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2, 20 µg
View other "USF2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223006 representing NM_207291
Red=Cloning site Green=Tags(s) MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRT ETNGGQAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQ TGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKG GILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997174 |
| Locus ID | 7392 |
| UniProt ID | Q15853 |
| Refseq Size | 1531 |
| Cytogenetics | 19q13.12 |
| Refseq ORF | 837 |
| Synonyms | bHLHb12; FIP |
| Summary | This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404074 | USF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418723 | USF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404074 | Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2 |
CNY 3080.00 |
|
| LY418723 | Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 1 |
CNY 3080.00 |
|
| PH323006 | USF2 MS Standard C13 and N15-labeled recombinant protein (NP_997174) |
CNY 14250.00 |
