USF2 (NM_207291) Human Mass Spec Standard
CAT#: PH323006
USF2 MS Standard C13 and N15-labeled recombinant protein (NP_997174)
View other "USF2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | USF2 MS Standard C13 and N15-labeled recombinant protein (NP_997174) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223006 |
Predicted MW | 30.4 kDa |
Protein Sequence |
>RC223006 representing NM_207291
Red=Cloning site Green=Tags(s) MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRT ETNGGQAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQ TGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKG GILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997174 |
RefSeq Size | 1531 |
RefSeq ORF | 837 |
Synonyms | bHLHb12; FIP |
Locus ID | 7392 |
Cytogenetics | 19q13.12 |
Summary | This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404074 | USF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418723 | USF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404074 | Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2 |
CNY 3080.00 |
|
LY418723 | Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 1 |
CNY 3080.00 |
|
TP323006 | Purified recombinant protein of Homo sapiens upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2, 20 µg |
CNY 2900.00 |