Rapsyn (RAPSN) (NM_005055) Human Recombinant Protein
CAT#: TP322710
Recombinant protein of human receptor-associated protein of the synapse (RAPSN), transcript variant 1, 20 µg
View other "Rapsyn" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222710 representing NM_005055
Red=Cloning site Green=Tags(s) MGQDQTKKQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYKEMLKFAVVQI DTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQ KALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNNYGKGWSLKYRAMSQY HMAVAYRLLGRLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIG NRLGQVQALLGVAKCWVARKALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVV RFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005046 |
Locus ID | 5913 |
UniProt ID | Q13702 |
Refseq Size | 1664 |
Cytogenetics | 11p11.2 |
Refseq ORF | 1236 |
Synonyms | CMS4C; CMS11; FADS; FADS2; RAPSYN; RNF205 |
Summary | This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403186 | RAPSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417541 | RAPSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403186 | Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 2 |
CNY 3080.00 |
|
LY417541 | Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 1 |
CNY 3080.00 |
|
PH322710 | RAPSN MS Standard C13 and N15-labeled recombinant protein (NP_005046) |
CNY 19520.00 |
|
TP762566 | Purified recombinant protein of Human receptor-associated protein of the synapse (RAPSN), transcript variant 2, 50ug |
CNY 2480.00 |