Rapsyn (RAPSN) (NM_005055) Human Mass Spec Standard
CAT#: PH322710
RAPSN MS Standard C13 and N15-labeled recombinant protein (NP_005046)
View other "Rapsyn" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAPSN MS Standard C13 and N15-labeled recombinant protein (NP_005046) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222710 |
| Predicted MW | 46.1 kDa |
| Protein Sequence |
>RC222710 representing NM_005055
Red=Cloning site Green=Tags(s) MGQDQTKKQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYKEMLKFAVVQI DTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQ KALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNNYGKGWSLKYRAMSQY HMAVAYRLLGRLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIG NRLGQVQALLGVAKCWVARKALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVV RFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005046 |
| RefSeq Size | 1664 |
| RefSeq ORF | 1236 |
| Synonyms | CMS4C; CMS11; FADS; FADS2; RAPSYN; RNF205 |
| Locus ID | 5913 |
| Cytogenetics | 11p11.2 |
| Summary | This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403186 | RAPSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417541 | RAPSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403186 | Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 2 |
CNY 3080.00 |
|
| LY417541 | Transient overexpression lysate of receptor-associated protein of the synapse (RAPSN), transcript variant 1 |
CNY 3080.00 |
|
| TP322710 | Recombinant protein of human receptor-associated protein of the synapse (RAPSN), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP762566 | Purified recombinant protein of Human receptor-associated protein of the synapse (RAPSN), transcript variant 2, 50ug |
CNY 2480.00 |
