CCDC140 (NM_153038) Human Recombinant Protein
CAT#: TP322414
Recombinant protein of human coiled-coil domain containing 140 (CCDC140), 20 µg
View other "CCDC140" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222414 protein sequence
Red=Cloning site Green=Tags(s) MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNRWRRQSCQGPS PARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEA EEMKKKKERKRRKERKKERNFKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_694583 |
Locus ID | 151278 |
UniProt ID | Q96MF4 |
Refseq Size | 1699 |
Cytogenetics | 2q36.1 |
Refseq ORF | 489 |
Synonyms | FLJ32447; MGC133159 |
Summary | This gene encodes a protein that appears to be restricted to select higher primate species. This protein contains a C-terminal coiled-coil domain, which is a versatile structural motif consisting of multiple amphipathic alpha-helices that twist around each other to form a supercoil. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407174 | CCDC140 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407174 | Transient overexpression lysate of coiled-coil domain containing 140 (CCDC140) |
CNY 3080.00 |
|
PH322414 | CCDC140 MS Standard C13 and N15-labeled recombinant protein (NP_694583) |
CNY 19520.00 |
其它CCDC140产品