CCDC140 (NM_153038) Human Mass Spec Standard
CAT#: PH322414
CCDC140 MS Standard C13 and N15-labeled recombinant protein (NP_694583)
View other "CCDC140" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CCDC140 MS Standard C13 and N15-labeled recombinant protein (NP_694583) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222414 |
| Predicted MW | 18.3 kDa |
| Protein Sequence |
>RC222414 protein sequence
Red=Cloning site Green=Tags(s) MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNRWRRQSCQGPS PARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEA EEMKKKKERKRRKERKKERNFKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_694583 |
| RefSeq Size | 1699 |
| RefSeq ORF | 489 |
| Synonyms | FLJ32447; MGC133159 |
| Locus ID | 151278 |
| Cytogenetics | 2q36.1 |
| Summary | This gene encodes a protein that appears to be restricted to select higher primate species. This protein contains a C-terminal coiled-coil domain, which is a versatile structural motif consisting of multiple amphipathic alpha-helices that twist around each other to form a supercoil. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407174 | CCDC140 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407174 | Transient overexpression lysate of coiled-coil domain containing 140 (CCDC140) |
CNY 3080.00 |
|
| TP322414 | Recombinant protein of human coiled-coil domain containing 140 (CCDC140), 20 µg |
CNY 2900.00 |
其它CCDC140产品
