Cofilin 2 (CFL2) (NM_138638) Human Recombinant Protein
CAT#: TP322215
Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 2, 20 µg
View other "Cofilin 2" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222215 protein sequence
Red=Cloning site Green=Tags(s) MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL DDIKDRSTLGEKLGGNVVVSLEGKPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_619579 |
Locus ID | 1073 |
UniProt ID | Q9Y281 |
Refseq Size | 3267 |
Cytogenetics | 14q13.1 |
Refseq ORF | 498 |
Synonyms | NEM7 |
Summary | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403364 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411884 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429663 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403364 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 2 |
CNY 3080.00 |
|
LY411884 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 1 |
CNY 3080.00 |
|
PH305105 | CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_068733) |
CNY 19520.00 |
|
PH322215 | CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579) |
CNY 19520.00 |
|
TP305105 | Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Cofilin 2产品