Cofilin 2 (CFL2) (NM_021914) Human Mass Spec Standard
CAT＃: PH305105
CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_068733)
View other "Cofilin 2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_068733) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205105 |
| Predicted MW | 18.7 kDa |
| Protein Sequence |
>RC205105 protein sequence
Red=Cloning site Green=Tags(s) MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL DDIKDRSTLGEKLGGNVVVSLEGKPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068733 |
| RefSeq Size | 3125 |
| RefSeq ORF | 498 |
| Synonyms | NEM7 |
| Locus ID | 1073 |
| Cytogenetics | 14q13.1 |
| Summary | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403364 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411884 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429663 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403364 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 2 |
CNY 3080.00 |
|
| LY411884 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 1 |
CNY 3080.00 |
|
| PH322215 | CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579) |
CNY 19520.00 |
|
| TP305105 | Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322215 | Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Cofilin 2产品
