RAD52 (NM_134424) Human Recombinant Protein
CAT#: TP322194
Recombinant protein of human RAD52 homolog (S. cerevisiae) (RAD52), 20 µg
View other "RAD52" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222194 representing NM_134424
Red=Cloning site Green=Tags(s) MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHR VINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLE KARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRP NMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVS TPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_602296 |
| Locus ID | 5893 |
| UniProt ID | P43351 |
| Refseq Size | 2673 |
| Cytogenetics | 12p13.33 |
| Refseq ORF | 1254 |
| Summary | The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair. A pseudogene of this gene is present on chromosome 2. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Homologous recombination |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Nickel nanoparticle-induced cell transformation: involvement of DNA damage and DNA repair defect through HIF-1α/miR-210/Rad52 pathway
,null,
Journal of Nanobiotechnology
,PubMed ID 34789290
[RAD52]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408748 | RAD52 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408748 | Transient overexpression lysate of RAD52 homolog (S. cerevisiae) (RAD52) |
CNY 4840.00 |
|
| PH322194 | RAD52 MS Standard C13 and N15-labeled recombinant protein (NP_602296) |
CNY 14250.00 |
|
| TP701005 | Purified recombinant protein of Human RAD52 homolog (S. cerevisiae) (RAD52), mutant (P183S), expressed in HEK293 cells, 20ug |
CNY 6650.00 |
