RAD52 (NM_134424) Human Mass Spec Standard
CAT#: PH322194
RAD52 MS Standard C13 and N15-labeled recombinant protein (NP_602296)
View other "RAD52" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | RAD52 MS Standard C13 and N15-labeled recombinant protein (NP_602296) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222194 |
| Predicted MW | 46 kDa |
| Protein Sequence |
>RC222194 representing NM_134424
Red=Cloning site Green=Tags(s) MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHR VINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLE KARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRP NMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVS TPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRAD PAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_602296 |
| RefSeq Size | 2673 |
| RefSeq ORF | 1254 |
| Locus ID | 5893 |
| Cytogenetics | 12p13.33 |
| Summary | The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair. A pseudogene of this gene is present on chromosome 2. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Homologous recombination |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408748 | RAD52 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408748 | Transient overexpression lysate of RAD52 homolog (S. cerevisiae) (RAD52) |
CNY 4840.00 |
|
| TP322194 | Recombinant protein of human RAD52 homolog (S. cerevisiae) (RAD52), 20 µg |
CNY 2900.00 |
|
| TP701005 | Purified recombinant protein of Human RAD52 homolog (S. cerevisiae) (RAD52), mutant (P183S), expressed in HEK293 cells, 20ug |
CNY 6650.00 |
