Thymosin beta 4 (TMSB4X) (NM_021109) Human Recombinant Protein

CAT#: TP322017

Recombinant protein of human thymosin beta 4, X-linked (TMSB4X), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "Thymosin beta 4" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00

CNY 6650.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (3)
Anti-TMSB4X Rabbit Polyclonal Antibody
    • 100 ul

CNY 1999.00
CNY 3280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC222017 representing NM_021109
Red=Cloning site Green=Tags(s)

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 4.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_066932
Locus ID 7114
UniProt ID P62328
Refseq Size 657
Cytogenetics Xp22.2
Refseq ORF 132
Synonyms FX; PTMB4; TB4X; TMSB4
Summary This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008]
Protein Pathways Regulation of actin cytoskeleton
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...