Thymosin beta 4 (TMSB4X) (NM_021109) Human Recombinant Protein
CAT#: TP322017
Recombinant protein of human thymosin beta 4, X-linked (TMSB4X), 20 µg
View other "Thymosin beta 4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222017 representing NM_021109
Red=Cloning site Green=Tags(s) MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 4.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066932 |
| Locus ID | 7114 |
| UniProt ID | P62328 |
| Refseq Size | 657 |
| Cytogenetics | Xp22.2 |
| Refseq ORF | 132 |
| Synonyms | FX; PTMB4; TB4X; TMSB4 |
| Summary | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412081 | TMSB4X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412081 | Transient overexpression lysate of thymosin beta 4, X-linked (TMSB4X) |
CNY 3080.00 |
|
| PH322017 | TMSB4X MS Standard C13 and N15-labeled recombinant protein (NP_066932) |
CNY 19520.00 |
其它Thymosin beta 4产品
