Thymosin beta 4 (TMSB4X) (NM_021109) Human Mass Spec Standard

Specifications

Product Data
Description	TMSB4X MS Standard C13 and N15-labeled recombinant protein (NP_066932)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC222017
Predicted MW	5.1 kDa
Protein Sequence	Sequence Link (showhide) >RC222017 representing NM_021109 Red=Cloning site Green=Tags(s) MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_066932
RefSeq Size	657
RefSeq ORF	132
Synonyms	FX; PTMB4; TB4X; TMSB4
Locus ID	7114
Cytogenetics	Xp22.2
Summary	This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq, Jul 2008]
Protein Pathways	Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.