BLOC1S3 (NM_212550) Human Recombinant Protein
CAT#: TP321221
Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 3 (BLOC1S3), 20 µg
View other "BLOC1S3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221221 representing NM_212550
Red=Cloning site Green=Tags(s) MASQGRRRRPLRRPETVVPGEATETDSERSASSSEEEELYLGPSGPTRGRPTGLRVAGEAAETDSEPEPE PEPTAAPRDLPPLVVQRESAEEAWGTEEAPAPAPARSLLQLRLAESQARLDHDVAAAVSGVYRRAGRDVA ALASRLAAAQAAGLAAAHSVRLARGDLCALAERLDIVAGCRLLPDIRGVPGTEPEKDPGPRA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997715 |
Locus ID | 388552 |
UniProt ID | Q6QNY0 |
Refseq Size | 609 |
Cytogenetics | 19q13.32 |
Refseq ORF | 606 |
Synonyms | BLOS3; HPS8; RP |
Summary | This gene encodes a protein that is a component of the BLOC1 multi-subunit protein complex. This complex is necessary for the biogenesis of specialized organelles of the endosomal-lysosomal system, including platelet dense granules and melanosomes. Mutations in this gene cause Hermansky-Pudlak syndrome 8, a disease characterized by lysosomal storage defects, bleeding due to platelet storage pool deficiency, and oculocutaneous albinism. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403894 | BLOC1S3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403894 | Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 3 (BLOC1S3) |
CNY 3080.00 |
|
PH321221 | BLOC1S3 MS Standard C13 and N15-labeled recombinant protein (NP_997715) |
CNY 19520.00 |
其它BLOC1S3产品