BLOC1S3 (NM_212550) Human Mass Spec Standard
CAT#: PH321221
BLOC1S3 MS Standard C13 and N15-labeled recombinant protein (NP_997715)
View other "BLOC1S3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | BLOC1S3 MS Standard C13 and N15-labeled recombinant protein (NP_997715) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221221 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC221221 representing NM_212550
Red=Cloning site Green=Tags(s) MASQGRRRRPLRRPETVVPGEATETDSERSASSSEEEELYLGPSGPTRGRPTGLRVAGEAAETDSEPEPE PEPTAAPRDLPPLVVQRESAEEAWGTEEAPAPAPARSLLQLRLAESQARLDHDVAAAVSGVYRRAGRDVA ALASRLAAAQAAGLAAAHSVRLARGDLCALAERLDIVAGCRLLPDIRGVPGTEPEKDPGPRA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997715 |
RefSeq Size | 609 |
RefSeq ORF | 606 |
Synonyms | BLOS3; HPS8; RP |
Locus ID | 388552 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a protein that is a component of the BLOC1 multi-subunit protein complex. This complex is necessary for the biogenesis of specialized organelles of the endosomal-lysosomal system, including platelet dense granules and melanosomes. Mutations in this gene cause Hermansky-Pudlak syndrome 8, a disease characterized by lysosomal storage defects, bleeding due to platelet storage pool deficiency, and oculocutaneous albinism. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403894 | BLOC1S3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403894 | Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 3 (BLOC1S3) |
CNY 3080.00 |
|
TP321221 | Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 3 (BLOC1S3), 20 µg |
CNY 2900.00 |
其它BLOC1S3产品