Calneuron 1 (CALN1) (NM_001017440) Human Recombinant Protein
CAT#: TP321065
Purified recombinant protein of Homo sapiens calneuron 1 (CALN1), transcript variant 2, 20 µg
View other "Calneuron 1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221065 representing NM_001017440
Red=Cloning site Green=Tags(s) MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA NQILRSGME myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001017440 |
Locus ID | 83698 |
UniProt ID | Q9BXU9 |
Refseq Size | 5802 |
Cytogenetics | 7q11.22 |
Refseq ORF | 657 |
Synonyms | CABP8 |
Summary | This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410502 | CALN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422736 | CALN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410502 | Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 1 |
CNY 3080.00 |
|
LY422736 | Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 2 |
CNY 3080.00 |
|
PH321065 | CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440) |
CNY 14250.00 |
|
TP761145 | Purified recombinant protein of Human calneuron 1 (CALN1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Calneuron 1产品