Calneuron 1 (CALN1) (NM_001017440) Human Mass Spec Standard
CAT#: PH321065
CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440)
View other "Calneuron 1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221065 |
| Predicted MW | 24.7 kDa |
| Protein Sequence |
>RC221065 representing NM_001017440
Red=Cloning site Green=Tags(s) MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA NQILRSGME myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001017440 |
| RefSeq Size | 5802 |
| RefSeq ORF | 657 |
| Synonyms | CABP8 |
| Locus ID | 83698 |
| Cytogenetics | 7q11.22 |
| Summary | This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410502 | CALN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422736 | CALN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410502 | Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 1 |
CNY 3080.00 |
|
| LY422736 | Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 2 |
CNY 3080.00 |
|
| TP321065 | Purified recombinant protein of Homo sapiens calneuron 1 (CALN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP761145 | Purified recombinant protein of Human calneuron 1 (CALN1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Calneuron 1产品
