Calneuron 1 (CALN1) (NM_001017440) Human Mass Spec Standard
CAT#: PH321065
CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440)
View other "Calneuron 1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221065 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC221065 representing NM_001017440
Red=Cloning site Green=Tags(s) MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA NQILRSGME myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001017440 |
RefSeq Size | 5802 |
RefSeq ORF | 657 |
Synonyms | CABP8 |
Locus ID | 83698 |
Cytogenetics | 7q11.22 |
Summary | This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410502 | CALN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422736 | CALN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410502 | Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 1 |
CNY 3080.00 |
|
LY422736 | Transient overexpression lysate of calneuron 1 (CALN1), transcript variant 2 |
CNY 3080.00 |
|
TP321065 | Purified recombinant protein of Homo sapiens calneuron 1 (CALN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761145 | Purified recombinant protein of Human calneuron 1 (CALN1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Calneuron 1产品