DLGAP4 (NM_001042486) Human Recombinant Protein
CAT#: TP321038
Recombinant protein of human discs, large (Drosophila) homolog-associated protein 4 (DLGAP4), transcript variant 3, 20 µg
View other "DLGAP4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221038 representing NM_001042486
Red=Cloning site Green=Tags(s) MSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPALEASSL PPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVG SAQLLMSQKFQQFRGLCEQNLNPDANPRPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPE KRKEEKKPPPPVPKKPAKSKPAVSRDKASDASDKQRQEARKRLLAAKRAASVRQNSATESADSIEIYVPE AQTRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035951 |
Locus ID | 22839 |
UniProt ID | Q9Y2H0 |
Refseq Size | 2982 |
Cytogenetics | 20q11.23 |
Refseq ORF | 855 |
Synonyms | DAP-4; DAP4; DLP4; SAPAP-4; SAPAP4 |
Summary | The product of this gene is a membrane-associated guanylate kinase found at the postsynaptic density in neuronal cells. It is a signaling molecule that can interact with potassium channels and receptors, as well as other signaling molecules. The protein encoded by this gene can interact with PSD-95 through its guanylate kinase domain and may be involved in clustering PSD-95 in the postsynaptic density region. The encoded protein is one of at least four similar proteins that have been found. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420937 | DLGAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420937 | Transient overexpression lysate of discs, large (Drosophila) homolog-associated protein 4 (DLGAP4), transcript variant 3 |
CNY 3080.00 |
|
PH321038 | DLGAP4 MS Standard C13 and N15-labeled recombinant protein (NP_001035951) |
CNY 19520.00 |