DLGAP4 (NM_001042486) Human Mass Spec Standard
CAT#: PH321038
DLGAP4 MS Standard C13 and N15-labeled recombinant protein (NP_001035951)
View other "DLGAP4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DLGAP4 MS Standard C13 and N15-labeled recombinant protein (NP_001035951) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221038 |
| Predicted MW | 31.5 kDa |
| Protein Sequence |
>RC221038 representing NM_001042486
Red=Cloning site Green=Tags(s) MSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPALEASSL PPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVG SAQLLMSQKFQQFRGLCEQNLNPDANPRPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPE KRKEEKKPPPPVPKKPAKSKPAVSRDKASDASDKQRQEARKRLLAAKRAASVRQNSATESADSIEIYVPE AQTRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035951 |
| RefSeq Size | 2982 |
| RefSeq ORF | 855 |
| Synonyms | DAP-4; DAP4; DLP4; SAPAP-4; SAPAP4 |
| Locus ID | 22839 |
| Cytogenetics | 20q11.23 |
| Summary | The product of this gene is a membrane-associated guanylate kinase found at the postsynaptic density in neuronal cells. It is a signaling molecule that can interact with potassium channels and receptors, as well as other signaling molecules. The protein encoded by this gene can interact with PSD-95 through its guanylate kinase domain and may be involved in clustering PSD-95 in the postsynaptic density region. The encoded protein is one of at least four similar proteins that have been found. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420937 | DLGAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420937 | Transient overexpression lysate of discs, large (Drosophila) homolog-associated protein 4 (DLGAP4), transcript variant 3 |
CNY 3080.00 |
|
| TP321038 | Recombinant protein of human discs, large (Drosophila) homolog-associated protein 4 (DLGAP4), transcript variant 3, 20 µg |
CNY 2900.00 |
